Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of BEGAIN polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC,IF,WB-Tr |
More info about BEGAIN polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB28732 |
| Product name: | BEGAIN polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant BEGAIN. |
| Isotype: | IgG |
| Gene id: | 57596 |
| Gene name: | BEGAIN |
| Gene alias: | KIAA1446 |
| Gene description: | brain-enriched guanylate kinase-associated homolog (rat) |
| Immunogen: | Recombinant protein corresponding to amino acids of human BEGAIN. |
| Immunogen sequence/protein sequence: | PYPAETFRFPASPGPQQALMPPNLWSLRAKPGTARLPGEDMRGQWRPLSVEDIGAYSYPVSAAGRASPCSFSERYYGGAGGSPGKKADGRASPLYASYKADSFSEGDDLSQGHLAEPCFLRAGGDLSLSPGRSADPLPGYAPSE |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:200-1:500) Immunofluorescence (1-4 ug/ml) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescent staining of human cell line A-431 with BEGAIN polyclonal antibody (Cat # PAB28732) at 1-4 ug/mL shows positivity in nucleus but not nucleoli and golgi apparatus. |
| Applications: | IHC,IF,WB-Tr |
| Shipping condition: | Dry Ice |