Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of S100A12 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC,IF,WB-Tr |
More info about S100A12 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB28697 |
| Product name: | S100A12 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant S100A12. |
| Isotype: | IgG |
| Gene id: | 6283 |
| Gene name: | S100A12 |
| Gene alias: | CAAF1|CAGC|CGRP|ENRAGE|MRP6|p6 |
| Gene description: | S100 calcium binding protein A12 |
| Immunogen: | Recombinant protein corresponding to amino acids of human S100A12. |
| Immunogen sequence/protein sequence: | KLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:500-1:1000) Immunofluorescence (1-4 ug/ml) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot anyalysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401723) with S100A12 polyclonal antibody (Cat # PAB28697) at 1:100-1:250 dilution. |
| Applications: | IHC,IF,WB-Tr |
| Shipping condition: | Dry Ice |