No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Rabbit |
| Applications | IHC,WB-Ce |
| Brand: | Abnova |
| Reference: | PAB28688 |
| Product name: | UQCRC1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant UQCRC1. |
| Isotype: | IgG |
| Gene id: | 7384 |
| Gene name: | UQCRC1 |
| Gene alias: | D3S3191|QCR1|UQCR1 |
| Gene description: | ubiquinol-cytochrome c reductase core protein I |
| Immunogen: | Recombinant protein corresponding to amino acids of human UQCRC1. |
| Immunogen sequence/protein sequence: | GDIVQNCSLEDSQIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQQLLDLAQKHLGG |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:200-1:500) Western Blot (1:100-1:500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: | ![]() |
| Application image note: | Western blot anyalysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells), Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla) with UQCRC1 polyclonal antibody (Cat # PAB28688). |
| Applications: | IHC,WB-Ce |
| Shipping condition: | Dry Ice |