| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Rabbit |
| Applications | WB,IHC,WB-Ce |
| Brand: | Abnova |
| Reference: | PAB28663 |
| Product name: | DPYSL2 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant DPYSL2. |
| Isotype: | IgG |
| Gene id: | 1808 |
| Gene name: | DPYSL2 |
| Gene alias: | CRMP2|DHPRP2|DRP-2|DRP2 |
| Gene description: | dihydropyrimidinase-like 2 |
| Immunogen: | Recombinant protein corresponding to amino acids of human DPYSL2. |
| Immunogen sequence/protein sequence: | DFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSR |
| Form: | liquid |
| Recommend dilutions: | Immunohistochemistry Western Blot The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: | ![]() |
| Application image note: | Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with DPYSL2 polyclonal antibody (Cat # PAB28663) at 1:100-1:500 dilution. |
| Applications: | WB,IHC,WB-Ce |
| Shipping condition: | Dry Ice |