SPARC polyclonal antibody View larger

SPARC polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPARC polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about SPARC polyclonal antibody

Brand: Abnova
Reference: PAB28625
Product name: SPARC polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SPARC.
Isotype: IgG
Gene id: 6678
Gene name: SPARC
Gene alias: ON
Gene description: secreted protein, acidic, cysteine-rich (osteonectin)
Immunogen: Recombinant protein corresponding to amino acids of human SPARC.
Immunogen sequence/protein sequence: VLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDL
Protein accession: P09486
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28625-48-35-1.jpg
Application image note: Immunohistochemical staining of human esophagus with SPARC polyclonal antibody (Cat # PAB28625) shows distinct positivity in fibroblasts.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy SPARC polyclonal antibody now

Add to cart