| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Rabbit |
| Applications | IHC-P |
| Product description: | Rabbit polyclonal antibody raised against recombinant BDKRB1. |
| Isotype: | IgG |
| Gene id: | 623 |
| Gene name: | BDKRB1 |
| Gene alias: | B1BKR|B1R|BKB1R|BKR1|BRADYB1 |
| Gene description: | bradykinin receptor B1 |
| Immunogen: | Recombinant protein corresponding to amino acids of human BDKRB1. |
| Immunogen sequence/protein sequence: | MASSWPPLELQSSNQSQLSPQNATACDNAPEAWDLLHRVLP |
| Protein accession: | G3V4Y2 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:20-1:50) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Size: | 100 uL |
| Shipping condition: | Dry Ice |