| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P |
| Brand: | Abnova |
| Reference: | PAB28574 |
| Product name: | ALDH1A1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant ALDH1A1. |
| Isotype: | IgG |
| Gene id: | 216 |
| Gene name: | ALDH1A1 |
| Gene alias: | ALDC|ALDH-E1|ALDH1|ALDH11|MGC2318|PUMB1|RALDH1 |
| Gene description: | aldehyde dehydrogenase 1 family, member A1 |
| Immunogen: | Recombinant protein corresponding to human ALDH1A1. |
| Immunogen sequence/protein sequence: | IYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGL |
| Protein accession: | P00352 |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (1:100-1:250) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human pancreas with ALDH1A1 polyclonal antibody (Cat # PAB28574) shows moderate cytoplasmic positivity in exocrine glandular cells. Retrieval method: HIER pH6 |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |