View larger

KDM6A polyclonal antibody

Reference:

Condition: New product

Data sheet of KDM6A polyclonal antibody

Brand	Abnova
Product type	Primary antibodies
Reactivity	Human
Host species	Rabbit
Applications	IHC-P

More info about KDM6A polyclonal antibody

Brand:	Abnova
Reference:	PAB28570
Product name:	KDM6A polyclonal antibody
Product description:	Rabbit polyclonal antibody raised against recombinant KDM6A.
Isotype:	IgG
Gene id:	7403
Gene name:	KDM6A
Gene alias:	UTX\|KABUK2\|bA386N14.2
Gene description:	lysine (K)-specific demethylase 6A
Immunogen:	Recombinant protein corresponding to human KDM6A.
Immunogen sequence/protein sequence:	IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT
Protein accession:	F5H5V6
Form:	Liquid
Recommend dilutions:	Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) The optimal working dilution should be determined by the end user.
Storage buffer:	In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction:	Store at 4Â°C. For long term storage store at -20Â°C. Aliquot to avoid repeated freezing and thawing.
Note:	This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human duodenum with KDM6A polyclonal antibody (Cat # PAB28570) shows strong nuclear positivity in glandular cells. Retrieval method: HIER pH6
Applications:	IHC-P
Shipping condition:	Dry Ice

Reviews

Be the first to write your review !

Buy KDM6A polyclonal antibody now

Add to cart