TFAP4 polyclonal antibody View larger

TFAP4 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TFAP4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about TFAP4 polyclonal antibody

Brand: Abnova
Reference: PAB28535
Product name: TFAP4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TFAP4.
Isotype: IgG
Gene id: 7023
Gene name: TFAP4
Gene alias: AP-4|bHLHc41
Gene description: transcription factor AP-4 (activating enhancer binding protein 4)
Immunogen: Recombinant protein corresponding to amino acids of human TFAP4.
Immunogen sequence/protein sequence: YFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEK
Protein accession: Q01664
Form: Liquid
Recommend dilutions: Western Blot (1:100-1:250)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28535-12-multi-1.jpg
Application image note: Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with TFAP4 polyclonal antibody (Cat # PAB28535).
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy TFAP4 polyclonal antibody now

Add to cart