GAL3ST1 polyclonal antibody View larger

GAL3ST1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GAL3ST1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about GAL3ST1 polyclonal antibody

Brand: Abnova
Reference: PAB28396
Product name: GAL3ST1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant GAL3ST1.
Isotype: IgG
Gene id: 9514
Gene name: GAL3ST1
Gene alias: CST
Gene description: galactose-3-O-sulfotransferase 1
Immunogen: Recombinant protein corresponding to human GAL3ST1.
Immunogen sequence/protein sequence: LLNILFRFGQKHRLKFAFPNGRNDFDYPTFFARSLVQDYRPGACFNIICNHMRFHYDEVRGLVPTNAIFITVLRDPARLFESSFHYFGPVVPLTWKLSAGDKLTEFLQDPDRYYDPNGFNAHYLRNLLFFDLGYDNSLDPSSPQVQEHIL
Protein accession: C9J6M2
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4 °C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28396-48-33-1.jpg
Application image note: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human prostate with GAL3ST1 polyclonal antibody (Cat # PAB28396) shows strong granular cytoplasmic positivity in glandular cells.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy GAL3ST1 polyclonal antibody now

Add to cart