View larger

LOC100130988 polyclonal antibody

Reference:

Condition: New product

Data sheet of LOC100130988 polyclonal antibody

Brand:	Abnova
Reference:	PAB28260
Product name:	LOC100130988 polyclonal antibody
Product description:	Rabbit polyclonal antibody raised against recombinant LOC100130988.
Isotype:	IgG
Gene id:	100130988
Gene name:	LOC100130988
Gene alias:	-
Gene description:	hypothetical protein LOC100130988
Immunogen:	Recombinant protein corresponding to amino acids of recombinant LOC100130988.
Immunogen sequence/protein sequence:	ANIPGYTGKVHFTATHPANSNIPSTTPSPDSELHRVFQKEMAVDLFRHQAPLSRLVTTVRPYNPFNKKDKETIDY
Protein accession:	A4D263
Form:	Liquid
Recommend dilutions:	Immunohistochemistry (1:20-1:50) The optimal working dilution should be determined by the end user.
Storage buffer:	In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction:	Store at 4Â°C. For long term storage store at -20Â°C. Aliquot to avoid repeated freezing and thawing.
Note:	This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Immunohistochemical staining of human skeletal muscle with LOC100130988 polyclonal antibody (Cat # PAB28260) shows moderate cytoplasmic positivity at 1:10-1:20 dilution.
Applications:	IHC-P
Shipping condition:	Dry Ice