CDRT4 polyclonal antibody View larger

CDRT4 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDRT4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about CDRT4 polyclonal antibody

Brand: Abnova
Reference: PAB28247
Product name: CDRT4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CDRT4.
Isotype: IgG
Gene id: 284040
Gene name: CDRT4
Gene alias: FLJ36674|MGC33988|NBLA10383
Gene description: CMT1A duplicated region transcript 4
Immunogen: Recombinant protein corresponding to amino acids of recombinant CDRT4.
Immunogen sequence/protein sequence: MDARRMKKEEGLTENTGLPRKLLEKHDPWPAYVTYTSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVI
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28247-48-8-1.jpg
Application image note: Immunohistochemical staining of human liver with CDRT4 polyclonal antibody (Cat # PAB28247) shows moderate cytoplasmic positivity in hepatocytes and bile duct cells are negative at 1:20-1:50 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy CDRT4 polyclonal antibody now

Add to cart