C3orf63 polyclonal antibody View larger

C3orf63 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C3orf63 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about C3orf63 polyclonal antibody

Brand: Abnova
Reference: PAB28235
Product name: C3orf63 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant C3orf63.
Isotype: IgG
Gene id: 23272
Gene name: C3orf63
Gene alias: DKFZp686C2456|KIAA1105|RAP140|se89-1
Gene description: chromosome 3 open reading frame 63
Immunogen: Recombinant protein corresponding to amino acids of recombinant C3orf63.
Immunogen sequence/protein sequence: GKWQWKVHCKFQKKLKELGRLNAKALSLLTLLNVYQKKHLVEILSYHNCDSQTRNAPELDCLIRLQAQNIQQRHIVFLTEKNIKMLSSYTDNGIVVATAEDFMQNFKNLVGYHNSITEENLPQLGANENLES
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28235-49-23-1.jpg
Application image note: Immunofluorescent staining of human cell line U-2 OS with C3orf63 polyclonal antibody (Cat # PAB28235) at 1-4 ug/ml shows positivity in nuclei but not nucleoli.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy C3orf63 polyclonal antibody now

Add to cart