CARKD polyclonal antibody View larger

CARKD polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CARKD polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about CARKD polyclonal antibody

Brand: Abnova
Reference: PAB28225
Product name: CARKD polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CARKD.
Isotype: IgG
Gene id: 55739
Gene name: CARKD
Gene alias: FLJ10769|FLJ34548|LP3298
Gene description: carbohydrate kinase domain containing
Immunogen: Recombinant protein corresponding to amino acids of recombinant CARKD.
Immunogen sequence/protein sequence: PNAVHEVEKWLPRLHALVVGPGLGRDDALLRNVQGILEVSKARDIPVVIDADGLWLVAQQPALIHGYRKAVLTPNHVEFSRLYDAVLRGPMDSDDSHGSVLRLSQALGNVTVVQ
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28225-48-38-1.jpg
Application image note: Immunohistochemical staining of human pancreas with CARKD polyclonal antibody (Cat # PAB28225) shows strong cytoplasmic positivity in exocrine glandular cells at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy CARKD polyclonal antibody now

Add to cart