TMED7-TICAM2 polyclonal antibody View larger

TMED7-TICAM2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TMED7-TICAM2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about TMED7-TICAM2 polyclonal antibody

Brand: Abnova
Reference: PAB28224
Product name: TMED7-TICAM2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TMED7-TICAM2.
Isotype: IgG
Gene id: 100302736
Gene name: TMED7-TICAM2
Gene alias: TAG
Gene description: TMED7-TICAM2 readthrough
Immunogen: Recombinant protein corresponding to amino acids of recombinant TMED7-TICAM2.
Immunogen sequence/protein sequence: ITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTF
Form: Liquid
Recommend dilutions: Western Blot (1:100-1:250)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28224-48-38-1.jpg
Application image note: Immunohistochemical staining of human pancreas with TMED7-TICAM2 polyclonal antibody (Cat # PAB28224) shows strong cytoplasmic positivity in exocrine glandular cells.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy TMED7-TICAM2 polyclonal antibody now

Add to cart