RP11-544M22.4 polyclonal antibody View larger

RP11-544M22.4 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RP11-544M22.4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about RP11-544M22.4 polyclonal antibody

Brand: Abnova
Reference: PAB28221
Product name: RP11-544M22.4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant RP11-544M22.4.
Isotype: IgG
Gene id: 100131187
Gene name: RP11-544M22.4
Gene alias: LOC100131187
Gene description: KAT protein
Immunogen: Recombinant protein corresponding to amino acids of recombinant RP11-544M22.4.
Immunogen sequence/protein sequence: MAGAPTVSLPELRSLLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKLEDEHLVFFCQMGKRGLQATQLARSLGYTGYG
Form: Liquid
Recommend dilutions: Western Blot (1:100-1:250)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28221-48-4-1.jpg
Application image note: Immunohistochemical staining of human stomach with RP11-544M22.4 polyclonal antibody (Cat # PAB28221) shows moderate cytoplasmic and some nuclear positivity in glandular cells.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy RP11-544M22.4 polyclonal antibody now

Add to cart