RPS13 polyclonal antibody View larger

RPS13 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RPS13 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about RPS13 polyclonal antibody

Brand: Abnova
Reference: PAB28218
Product name: RPS13 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant RPS13.
Isotype: IgG
Gene id: 6207
Gene name: RPS13
Gene alias: -
Gene description: ribosomal protein S13
Immunogen: Recombinant protein corresponding to amino acids of recombinant RPS13.
Immunogen sequence/protein sequence: RSVPTWLKLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLPPNWKYESSTA
Protein accession: P62277
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28218-48-5-1.jpg
Application image note: Immunohistochemical staining of human tonsil with RPS13 polyclonal antibody (Cat # PAB28218) shows strong cytoplasmic and membranous positivity in subsets of cells at 1:10-1:20 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy RPS13 polyclonal antibody now

Add to cart