DDX60L polyclonal antibody View larger

DDX60L polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DDX60L polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about DDX60L polyclonal antibody

Brand: Abnova
Reference: PAB28195
Product name: DDX60L polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DDX60L.
Isotype: IgG
Gene id: 91351
Gene name: DDX60L
Gene alias: DKFZp781D1175|FLJ13468|FLJ31033|FLJ39050
Gene description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 60-like
Immunogen: Recombinant protein corresponding to amino acids of recombinant DDX60L.
Immunogen sequence/protein sequence: QEPHLNLGDSIRRDYEDLWNVVSHLVKEFNLGKSFPLRTTRRHFLRQEKSVIQEISLEKMPSVGFIPMTSAVIDEFVGDMMKDL
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28195-48-38-1.jpg
Application image note: Immunohistochemical staining of human pancreas with DDX60L polyclonal antibody (Cat # PAB28195) shows strong cytoplasmic positivity in exocrine glandular cells at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy DDX60L polyclonal antibody now

Add to cart