C1orf50 polyclonal antibody View larger

C1orf50 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C1orf50 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about C1orf50 polyclonal antibody

Brand: Abnova
Reference: PAB28193
Product name: C1orf50 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant C1orf50.
Isotype: IgG
Gene id: 79078
Gene name: C1orf50
Gene alias: MGC955
Gene description: chromosome 1 open reading frame 50
Immunogen: Recombinant protein corresponding to amino acids of recombinant C1orf50.
Immunogen sequence/protein sequence: HHVACNIVKKPGNIYYLYKRESGQQYFSIISPKEWGTSCPHDFLGAYKLQHDLSWTPYEDIEKQDAKISMMDTLLSQSVALPPCTEPNFQGLTH
Protein accession: Q9BV19
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28193-51-89-1.jpg
Application image note: Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with C1orf50 polyclonal antibody (Cat # PAB28193).
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C1orf50 polyclonal antibody now

Add to cart