TMEM144 polyclonal antibody View larger

TMEM144 polyclonal antibody

New product

375,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TMEM144 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesRabbit
ApplicationsIHC-P

More info about TMEM144 polyclonal antibody

Product description: Rabbit polyclonal antibody raised against recombinant TMEM144.
Isotype: IgG
Gene id: 55314
Gene name: TMEM144
Gene alias: FLJ11155
Gene description: transmembrane protein 144
Immunogen: Recombinant protein corresponding to amino acids of recombinant TMEM144.
Immunogen sequence/protein sequence: CSMDTTPLITEHVINTTQDPCSWVDKLSTVHHRI
Protein accession: Q7Z5S9
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Size: 100 uL
Shipping condition: Dry Ice

Reviews

Buy TMEM144 polyclonal antibody now

Add to cart