CCDC19 polyclonal antibody View larger

CCDC19 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCDC19 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about CCDC19 polyclonal antibody

Brand: Abnova
Reference: PAB28144
Product name: CCDC19 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CCDC19.
Isotype: IgG
Gene id: 25790
Gene name: CCDC19
Gene alias: NESG1
Gene description: coiled-coil domain containing 19
Immunogen: Recombinant protein corresponding to amino acids of recombinant CCDC19.
Immunogen sequence/protein sequence: KEATMDAVMTRKKIMKQKEMVWNNNKKLSDLEEVAKERAQNLLQRANKLRMEQEEELKDMSKIILNAKCHAIRDAQILEKQQI
Protein accession: Q9UL16
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28144-49-4-1.jpg
Application image note: Immunofluorescent staining of human cell line A-431 with CCDC19 polyclonal antibody (Cat # PAB28144) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy CCDC19 polyclonal antibody now

Add to cart