ATPBD4 polyclonal antibody View larger

ATPBD4 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATPBD4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about ATPBD4 polyclonal antibody

Brand: Abnova
Reference: PAB28034
Product name: ATPBD4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ATPBD4
Isotype: IgG
Gene id: 89978
Gene name: ATPBD4
Gene alias: MGC14798
Gene description: ATP binding domain 4
Immunogen: Recombinant protein corresponding to amino acids of human ATPBD4
Immunogen sequence/protein sequence: ISGGKDSCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDLYAEAMALPLYRRTIRGRSLDTRQVYTKCE
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200 - 1:500)
Immunoflurorescence (1-4 µg/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28034-48-38-1.jpg
Application image note: Immunohistochemical staining of human pancreas with ATPBD4 polyclonal antibody ( Cat # PAB28034 ) shows strong cytoplasmic positivity in islets of Langerhans.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy ATPBD4 polyclonal antibody now

Add to cart