C20orf112 polyclonal antibody View larger

C20orf112 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C20orf112 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about C20orf112 polyclonal antibody

Brand: Abnova
Reference: PAB27908
Product name: C20orf112 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant C20orf112.
Isotype: IgG
Gene id: 140688
Gene name: C20orf112
Gene alias: C20orf113|DKFZp566G1424|dJ1184F4.2|dJ1184F4.4
Gene description: chromosome 20 open reading frame 112
Immunogen: Recombinant protein corresponding to amino acids of human C20orf112.
Immunogen sequence/protein sequence: SDGCGADGLRSRVKYGVKTTPESPPYSSGSYDSIKTEVSGCPEDLTVGRAPTADDDDDDHDDHEDNDKMNDSEGMDPERL
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27908-48-258-1.jpg
Application image note: Immunohistochemical staining of human rectum with C20orf112 polyclonal antibody (Cat # PAB27908) shows strong nuclear positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy C20orf112 polyclonal antibody now

Add to cart