View larger

KDELC2 polyclonal antibody

Reference:

Condition: New product

Data sheet of KDELC2 polyclonal antibody

Brand:	Abnova
Reference:	PAB27866
Product name:	KDELC2 polyclonal antibody
Product description:	Rabbit polyclonal antibody raised against recombinant KDELC2.
Isotype:	IgG
Gene id:	143888
Gene name:	KDELC2
Gene alias:	MGC33424
Gene description:	KDEL (Lys-Asp-Glu-Leu) containing 2
Immunogen:	Recombinant protein corresponding to amino acids of human KDELC2.
Immunogen sequence/protein sequence:	YHEYCECPEDPQAWQKTLSCPTKEPQIAKDFASFPSINLQQMLKEVPKRFGDERGAIVHYTILNNHVYRRSLGKYTDFKMFSDEI
Form:	Liquid
Recommend dilutions:	Immunohistochemistry (1:500-1:1000) Western Blot (1:100-1:250) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
Storage buffer:	In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction:	Store at 4Â°C. For long term storage store at -20Â°C. Aliquot to avoid repeated freezing and thawing.
Note:	This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Immunohistochemical staining of human placenta with KDELC2 polyclonal antibody (Cat # PAB27866) shows strong cytoplasmic positivity in trophoblastic cells at 1:500-1:1000 dilution.
Applications:	IHC-P,IF,WB-Tr
Shipping condition:	Dry Ice