View larger

KCNJ12 polyclonal antibody

Reference:

Condition: New product

Data sheet of KCNJ12 polyclonal antibody

Brand:	Abnova
Reference:	PAB27489
Product name:	KCNJ12 polyclonal antibody
Product description:	Rabbit polyclonal antibody raised against recombinant KCNJ12.
Isotype:	IgG
Gene id:	3768
Gene name:	KCNJ12
Gene alias:	FLJ14167\|IRK2\|KCNJN1\|Kir2.2\|Kir2.2v\|hIRK\|hIRK1\|hkir2.2x\|kcnj12x
Gene description:	potassium inwardly-rectifying channel, subfamily J, member 12
Immunogen:	Recombinant protein corresponding to amino acids of human KCNJ12.
Immunogen sequence/protein sequence:	RCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI
Form:	Liquid
Recommend dilutions:	Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user.
Storage buffer:	In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction:	Store at 4Â°C. For long term storage store at -20Â°C. Aliquot to avoid repeated freezing and thawing.
Note:	This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Immunohistochemical staining of human kidney with KCNJ12 polyclonal antibody (Cat # PAB27489) shows strong cytoplasmic positivity in tubular cells at 1:200-1:500 dilution.
Applications:	IHC-P
Shipping condition:	Dry Ice