KCNJ12 polyclonal antibody View larger

KCNJ12 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KCNJ12 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about KCNJ12 polyclonal antibody

Brand: Abnova
Reference: PAB27489
Product name: KCNJ12 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant KCNJ12.
Isotype: IgG
Gene id: 3768
Gene name: KCNJ12
Gene alias: FLJ14167|IRK2|KCNJN1|Kir2.2|Kir2.2v|hIRK|hIRK1|hkir2.2x|kcnj12x
Gene description: potassium inwardly-rectifying channel, subfamily J, member 12
Immunogen: Recombinant protein corresponding to amino acids of human KCNJ12.
Immunogen sequence/protein sequence: RCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27489-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with KCNJ12 polyclonal antibody (Cat # PAB27489) shows strong cytoplasmic positivity in tubular cells at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy KCNJ12 polyclonal antibody now

Add to cart