SOX7 polyclonal antibody View larger

SOX7 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SOX7 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about SOX7 polyclonal antibody

Brand: Abnova
Reference: PAB27480
Product name: SOX7 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SOX7.
Isotype: IgG
Gene id: 83595
Gene name: SOX7
Gene alias: MGC10895
Gene description: SRY (sex determining region Y)-box 7
Immunogen: Recombinant protein corresponding to amino acids of human SOX7.
Immunogen sequence/protein sequence: LNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTP
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27480-48-51-1.jpg
Application image note: Immunohistochemical staining of human cerebral cortex with SOX7 polyclonal antibody (Cat # PAB27480) shows strong nuclear positivity in neuronal cells at 1:50-1:200 dilution.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy SOX7 polyclonal antibody now

Add to cart