ABTB2 polyclonal antibody View larger

ABTB2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ABTB2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about ABTB2 polyclonal antibody

Brand: Abnova
Reference: PAB27475
Product name: ABTB2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ABTB2.
Isotype: IgG
Gene id: 25841
Gene name: ABTB2
Gene alias: DKFZp586C1619
Gene description: ankyrin repeat and BTB (POZ) domain containing 2
Immunogen: Recombinant protein corresponding to amino acids of human ABTB2.
Immunogen sequence/protein sequence: IPTTDILELLSAASLFQLDALQRHCEILCSQTLSMESAVNTYKYAKIHNAPELALFCEGFFLKHMKALLEQDA
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27475-48-51-1.jpg
Application image note: Immunohistochemical staining of human cerebral cortex with ABTB2 polyclonal antibody (Cat # PAB27475) shows strong cytoplasmic positivity in glial cells.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy ABTB2 polyclonal antibody now

Add to cart