SELM polyclonal antibody View larger

SELM polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SELM polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about SELM polyclonal antibody

Brand: Abnova
Reference: PAB27474
Product name: SELM polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SELM.
Isotype: IgG
Gene id: 140606
Gene name: SELM
Gene alias: MGC40146|SEPM
Gene description: selenoprotein M
Immunogen: Recombinant protein corresponding to amino acids of human SELM.
Immunogen sequence/protein sequence: QDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHA
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27474-48-71-1.jpg
Application image note: Immunohistochemical staining of human thyroid gland with SELM polyclonal antibody(Cat # PAB27474) shows strong cytoplasmic positivity in glandular cells.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy SELM polyclonal antibody now

Add to cart