ZNF135 polyclonal antibody View larger

ZNF135 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF135 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about ZNF135 polyclonal antibody

Brand: Abnova
Reference: PAB27462
Product name: ZNF135 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ZNF135.
Isotype: IgG
Gene id: 7694
Gene name: ZNF135
Gene alias: ZNF61|ZNF78L1|pHZ-17|pT3
Gene description: zinc finger protein 135
Immunogen: Recombinant protein corresponding to amino acids of human ZNF135.
Immunogen sequence/protein sequence: FLWDGLWYCRGEDTEGHWEWSCESLESLAVPVAFTPVKTPVLEQWQRNGFGENISLNPDLPHQPMTPERQSPHTWGTRGKREKPDLNVLQKTCVKEKPYKCQECGKAFSHSSALI
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27462-48-7-1.jpg
Application image note: Immunohistochemical staining of human colon with ZNF135 polyclonal antibody (Cat # PAB27461) shows strong nuclear and cytoplasmic positivity in glandular cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF135 polyclonal antibody now

Add to cart