View larger

LGALS7B polyclonal antibody

Reference:

Condition: New product

Data sheet of LGALS7B polyclonal antibody

Brand:	Abnova
Reference:	PAB27459
Product name:	LGALS7B polyclonal antibody
Product description:	Rabbit polyclonal antibody raised against recombinant LGALS7B.
Isotype:	IgG
Gene id:	653499
Gene name:	LGALS7B
Gene alias:	GAL7\|HKL-14\|LGALS7\|MGC75149\|MGC88745\|PI7
Gene description:	lectin, galactoside-binding, soluble, 7B
Immunogen:	Recombinant protein corresponding to amino acids of human LGALS7B.
Immunogen sequence/protein sequence:	PHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSV
Form:	Liquid
Recommend dilutions:	Immunohistochemistry (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
Storage buffer:	In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction:	Store at 4Â°C. For long term storage store at -20Â°C. Aliquot to avoid repeated freezing and thawing.
Note:	This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Immunohistochemical staining of human cervix, uterine with LGALS7B polyclonal antibody (Cat # PAB27459) shows moderate nuclear positivity in squamous epithelial cells.
Applications:	IHC-P,WB-Tr
Shipping condition:	Dry Ice