LGALS7B polyclonal antibody View larger

LGALS7B polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LGALS7B polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about LGALS7B polyclonal antibody

Brand: Abnova
Reference: PAB27459
Product name: LGALS7B polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant LGALS7B.
Isotype: IgG
Gene id: 653499
Gene name: LGALS7B
Gene alias: GAL7|HKL-14|LGALS7|MGC75149|MGC88745|PI7
Gene description: lectin, galactoside-binding, soluble, 7B
Immunogen: Recombinant protein corresponding to amino acids of human LGALS7B.
Immunogen sequence/protein sequence: PHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSV
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27459-48-5-1.jpg
Application image note: Immunohistochemical staining of human cervix, uterine with LGALS7B polyclonal antibody (Cat # PAB27459) shows moderate nuclear positivity in squamous epithelial cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LGALS7B polyclonal antibody now

Add to cart