RIMBP3 polyclonal antibody View larger

RIMBP3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RIMBP3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about RIMBP3 polyclonal antibody

Brand: Abnova
Reference: PAB27458
Product name: RIMBP3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant RIMBP3.
Isotype: IgG
Gene id: 85376
Gene name: RIMBP3
Gene alias: DKFZp434H0735|KIAA1666|RIMBP3.1|RIMBP3A
Gene description: RIMS binding protein 3
Immunogen: Recombinant protein corresponding to amino acids of human RIMBP3.
Immunogen sequence/protein sequence: RDTASEVDDLEPDSVSLALEMGGSAAPAAPKLKIFMAQYNYNPFEGPNDHPEGELPLTAGDYIYIFGDMDEDGFYEGELEDGRRGLVPSNFVEQIPDSYIPGCLPAKSPDLGPSQLPAGQDEALEE
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27458-48-12-1.jpg
Application image note: Immunohistochemical staining of human breast with RIMBP3 polyclonal antibody (Cat # PAB27458) shows strong cytoplasmic positivity in cells in seminiferus ducts.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy RIMBP3 polyclonal antibody now

Add to cart