Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 384,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 384,00 €
Data sheet of BEST2 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about BEST2 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB24487 |
| Product name: | BEST2 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant BEST2. |
| Isotype: | IgG |
| Gene id: | 54831 |
| Gene name: | BEST2 |
| Gene alias: | FLJ20132|VMD2L1 |
| Gene description: | bestrophin 2 |
| Immunogen: | Recombinant protein corresponding to amino acids of human BEST2. |
| Immunogen sequence/protein sequence: | RRLSFLLRKNSCVSEASTGASCSCAVVPEGAAPECSCGDPLLDPGLPEPEAPPPAGPEPLTLIPGPVEPFSIVTMP |
| Protein accession: | Q8NFU1 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining of human pancreas with BEST2 polyclonal antibody (Cat # PAB24487) shows strong cytoplasmic positivity in exocrine glandular cells at 1:200-1:500 dilution. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Lineage-Specific Expression of Bestrophin-2 and Bestrophin-4 in Human Intestinal Epithelial Cells.Ito G, Okamoto R, Murano T, Shimizu H, Fujii S, Nakata T, Mizutani T, Yui S, Akiyama-Morio J, Nemoto Y, Okada E, Araki A, Ohtsuka K, Tsuchiya K, Nakamura T, Watanabe M. PLoS ONE 8(11): e79693. |