| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
| Brand: | Abnova |
| Reference: | PAB24461 |
| Product name: | GABRE polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant GABRE. |
| Isotype: | IgG |
| Gene id: | 2564 |
| Gene name: | GABRE |
| Gene alias: | - |
| Gene description: | gamma-aminobutyric acid (GABA) A receptor, epsilon |
| Immunogen: | Recombinant protein corresponding to amino acids of human GABRE. |
| Immunogen sequence/protein sequence: | PQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVEIAVNSLGPL |
| Protein accession: | P78334 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunohistochemical staining of human kidney with GABRE polyclonal antibody (Cat # PAB24461) shows strong cytoplasmic positivity in renal tubules at 1:500-1:1000 dilution. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Human breast cancer metastases to the brain display GABAergic properties in the neural niche.Neman J, Termini J, Wilczynski S, Vaidehi N, Choy C, Kowolik CM, Li H, Hambrecht AC, Roberts E, Jandial R Proc Natl Acad Sci U S A. 2014 Jan 6. |