SPANXN4 polyclonal antibody View larger

SPANXN4 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPANXN4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SPANXN4 polyclonal antibody

Brand: Abnova
Reference: PAB24443
Product name: SPANXN4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SPANXN4.
Isotype: IgG
Gene id: 441525
Gene name: SPANXN4
Gene alias: SPANX-N4
Gene description: SPANX family, member N4
Immunogen: Recombinant protein corresponding to amino acids of human SPANXN4.
Immunogen sequence/protein sequence: KEKGDLDISAGSPQDGEEEKDLVFLGARACLEEHIRRSVLYVGDSDTLSKMKTSESPPSGHIPQSGVFCNSPNAV
Protein accession: Q5MJ08
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24443-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with SPANXN4 polyclonal antibody (Cat # PAB24443) shows strong cytoplasmic positivity in cells of tubules at 1:10-1:20 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SPANXN4 polyclonal antibody now

Add to cart