MRPS26 polyclonal antibody View larger

MRPS26 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MRPS26 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about MRPS26 polyclonal antibody

Brand: Abnova
Reference: PAB24417
Product name: MRPS26 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant MRPS26.
Isotype: IgG
Gene id: 64949
Gene name: MRPS26
Gene alias: C20orf193|GI008|MRP-S13|MRP-S26|MRPS13|NY-BR-87|RPMS13|dJ534B8.3
Gene description: mitochondrial ribosomal protein S26
Immunogen: Recombinant protein corresponding to amino acids of human MRPS26.
Immunogen sequence/protein sequence: EVLQLQEEVKNFITRENLEARVEAALDSRKNYNWAITREGLVVRPQRRDS
Protein accession: Q9BYN8
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24417-48-A2-1.jpg
Application image note: Immunohistochemical staining of human colon with MRPS26 polyclonal antibody (Cat # PAB24417) shows strong granular cytoplasmic positivity in glandular cells at 1:200-1:500 dilution.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy MRPS26 polyclonal antibody now

Add to cart