HM13 polyclonal antibody View larger

HM13 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HM13 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about HM13 polyclonal antibody

Brand: Abnova
Reference: PAB24385
Product name: HM13 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant HM13.
Isotype: IgG
Gene id: 81502
Gene name: HM13
Gene alias: H13|IMP1|IMPAS|MSTP086|PSENL3|PSL3|SPP|dJ324O17.1
Gene description: histocompatibility (minor) 13
Immunogen: Recombinant protein corresponding to amino acids of human HM13.
Immunogen sequence/protein sequence: PASFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGC
Protein accession: Q8TCT9
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24385-48-A7-1.jpg
Application image note: Immunohistochemical staining of human pancreas with HM13 polyclonal antibody (Cat # PAB24385) shows strong cytoplasmic positivity in exocrine cells at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy HM13 polyclonal antibody now

Add to cart