MXRA7 polyclonal antibody View larger

MXRA7 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MXRA7 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about MXRA7 polyclonal antibody

Brand: Abnova
Reference: PAB24365
Product name: MXRA7 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant MXRA7.
Isotype: IgG
Gene id: 439921
Gene name: MXRA7
Gene alias: FLJ41492|FLJ46603|PS1TP1|TMAP1
Gene description: matrix-remodelling associated 7
Immunogen: Recombinant protein corresponding to amino acids of human MXRA7.
Immunogen sequence/protein sequence: GPSSEGPEEEDGEGFSFKYSPGKLRGNQYKKMMTKEELEEEQRVQKEQLAAIFKLMKDNKETFGEMSDGDVQEQL
Protein accession: P84157
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24365-48-41-1.jpg
Application image note: Immunohistochemical staining of human placenta with MXRA7 polyclonal antibody (Cat # PAB24365) shows strong cytoplasmic positivity in decidual cells at 1:1000-1:2500 dilution.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy MXRA7 polyclonal antibody now

Add to cart