MFSD8 polyclonal antibody View larger

MFSD8 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MFSD8 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF,WB-Tr

More info about MFSD8 polyclonal antibody

Brand: Abnova
Reference: PAB24363
Product name: MFSD8 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant MFSD8.
Isotype: IgG
Gene id: 256471
Gene name: MFSD8
Gene alias: CLN7|MGC33302
Gene description: major facilitator superfamily domain containing 8
Immunogen: Recombinant protein corresponding to amino acids of human MFSD8.
Immunogen sequence/protein sequence: MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWR
Protein accession: Q8NHS3
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24363-49-187-1.jpg
Application image note: Immunofluorescent staining of human cell line U-251 MG with MFSD8 polyclonal antibody (Cat # PAB24363) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli and vesicles.
Applications: IHC-P,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MFSD8 polyclonal antibody now

Add to cart