| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB,IHC-P |
| Brand: | Abnova |
| Reference: | PAB24025 |
| Product name: | IRGQ polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant IRGQ. |
| Isotype: | IgG |
| Gene id: | 126298 |
| Gene name: | IRGQ |
| Gene alias: | FKSG27|FLJ12521|FLJ38849|FLJ42796|FLJ46713|IRGQ1 |
| Gene description: | immunity-related GTPase family, Q |
| Immunogen: | Recombinant protein corresponding to amino acids of human IRGQ. |
| Immunogen sequence/protein sequence: | PPGLGKSALIAALCDKDVETLEAPEGRPDSGVPSLRAAGPGLFLGELSCPPAAPGPWAAEANVLVLVLPGPEGNGEPLAPAL |
| Protein accession: | Q8WZA9 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunohistochemical staining of human colon with IRGQ polyclonal antibody (Cat # PAB24025) shows moderate cytoplasmic positivity in glandular cells. |
| Applications: | WB,IHC-P |
| Shipping condition: | Dry Ice |