View larger

NARFL polyclonal antibody

Reference:

Condition: New product

Data sheet of NARFL polyclonal antibody

Brand:	Abnova
Reference:	PAB23706
Product name:	NARFL polyclonal antibody
Product description:	Rabbit polyclonal antibody raised against recombinant NARFL.
Isotype:	IgG
Gene id:	64428
Gene name:	NARFL
Gene alias:	FLJ21988\|HPRN\|IOP1\|LET1L\|PRN
Gene description:	nuclear prelamin A recognition factor-like
Immunogen:	Recombinant protein corresponding to amino acids of human NARFL.
Immunogen sequence/protein sequence:	KLEASRPDFFNQEHQTRDVDCVLTTGEVFRLLEEEGVSLPDLEPAPLDSLCSGASAEEPTSHRGGGSGGYLEHVFRHAARELFGIHVAEVTYKP
Protein accession:	Q9H6Q4
Form:	Liquid
Recommend dilutions:	Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
Storage buffer:	In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction:	Store at 4Â°C. For long term storage store at -20Â°C. Aliquot to avoid repeated freezing and thawing.
Note:	This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Immunohistochemical staining of human kidney with NARFL polyclonal antibody (Cat # PAB23706) shows strong cytoplasmic positivity in distal tubules at 1:200-1:500 dilution.
Applications:	WB,IHC-P
Shipping condition:	Dry Ice