Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RBM26 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about RBM26 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB23478 |
| Product name: | RBM26 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant RBM26. |
| Isotype: | IgG |
| Gene id: | 64062 |
| Gene name: | RBM26 |
| Gene alias: | ARRS2|C13orf10|FLJ20957|MGC133295|MGC133296|PRO1777|RP11-255E21.1|SE70-2|ZC3H17 |
| Gene description: | RNA binding motif protein 26 |
| Immunogen: | Recombinant protein corresponding to amino acids of human RBM26. |
| Immunogen sequence/protein sequence: | PPLTPLQPSGMDAPPNSATSSVPTVVTTGIHHQPPPAPPSLFTADTYDTDGY |
| Protein accession: | Q5T8P6 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining of human rectum with RBM26 polyclonal antibody (Cat # PAB23478) shows strong nuclear positivity in glandular cells. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |