PDS5B polyclonal antibody View larger

PDS5B polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PDS5B polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about PDS5B polyclonal antibody

Brand: Abnova
Reference: PAB23472
Product name: PDS5B polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant PDS5B.
Isotype: IgG
Gene id: 23047
Gene name: PDS5B
Gene alias: APRIN|AS3|CG008|FLJ23236|KIAA0979|RP1-267P19.1
Gene description: PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human PDS5B.
Immunogen sequence/protein sequence: GSQRSRKRGHTASESDEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKTSKKGSKKKSGPPAPEEEE
Protein accession: Q9NTI5
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB23472-49-4-1.jpg
Application image note: Immunofluorescent staining of human cell line A-431 with PDS5B polyclonal antibody (Cat # PAB23472) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy PDS5B polyclonal antibody now

Add to cart