Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLC2A7 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about SLC2A7 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB23464 |
| Product name: | SLC2A7 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant SLC2A7. |
| Isotype: | IgG |
| Gene id: | 155184 |
| Gene name: | SLC2A7 |
| Gene alias: | GLUT7 |
| Gene description: | solute carrier family 2 (facilitated glucose transporter), member 7 |
| Immunogen: | Recombinant protein corresponding to amino acids of human SLC2A7. |
| Immunogen sequence/protein sequence: | SVVNTPHKVFKSFYNETYFERHATFMDGKLM |
| Protein accession: | Q6PXP3 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:10-1:20) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining of human liver with SLC2A7 polyclonal antibody (Cat # PAB23464) shows strong cytoplasmic positivity in granular pattern in hepatocytes at 1:10-1:20 dilution. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Immunoreactivity of glucose transporter 8 is localized in the epithelial cells of the choroid plexus and in ependymal cells.Murakami R, Chiba Y, Tsuboi K, Matsumoto K, Kawauchi M, Fujihara R, Mashima M, Kanenishi K, Yamamoto T, Ueno M. Histochem Cell Biol. 2016 May 9. [Epub ahead of print] |