| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
| Brand: | Abnova |
| Reference: | PAB23462 |
| Product name: | FLJ32810 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant FLJ32810. |
| Isotype: | IgG |
| Gene id: | 143872 |
| Gene name: | FLJ32810 |
| Gene alias: | - |
| Gene description: | hypothetical protein FLJ32810 |
| Immunogen: | Recombinant protein corresponding to amino acids of human FLJ32810. |
| Immunogen sequence/protein sequence: | DPSIPLPQPQSRSGSRRTRAICLSTGSRKPRGRYTPCLAEPDSDSYSSSPDSTPMGSIESLSSHSSEQNSTTKSASCQ |
| Protein accession: | A6NI28 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunohistochemical staining of human testis with FLJ32810 polyclonal antibody (Cat # PAB23462) shows strong cytoplasmic positivity in cells of seminiferus ducts. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | The smooth muscle-selective RhoGAP GRAF3 is a critical regulator of vascular tone and hypertension.Bai X, Lenhart KC, Bird KE, Suen AA, Rojas M, Kakoki M, Li F, Smithies O, Mack CP, Taylor JM Nat Commun. 2013 Dec 13;4:2910. doi: 10.1038/ncomms3910. |