KIAA0256 polyclonal antibody View larger

KIAA0256 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KIAA0256 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about KIAA0256 polyclonal antibody

Brand: Abnova
Reference: PAB23455
Product name: KIAA0256 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant KIAA0256.
Isotype: IgG
Gene id: 9728
Gene name: KIAA0256
Gene alias: -
Gene description: KIAA0256 gene product
Immunogen: Recombinant protein corresponding to amino acids of human KIAA0256.
Immunogen sequence/protein sequence: EEALKNVKKVPHHMGHSRNPSAASAISFCSVISEPISEVNEKEYETNWRNMVETSDGLEASENEKEVSCKHSTSEKPSKLPFDTPAIGKQPSLVATGSTTSATSAGKSTASDK
Protein accession: Q93073
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23455-48-33-1.jpg
Application image note: Immunohistochemical staining of human prostate with KIAA0256 polyclonal antibody (Cat # PAB23455) shows strong cytoplasmic positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy KIAA0256 polyclonal antibody now

Add to cart