BET1L polyclonal antibody View larger

BET1L polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BET1L polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about BET1L polyclonal antibody

Brand: Abnova
Reference: PAB23453
Product name: BET1L polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant BET1L.
Isotype: IgG
Gene id: 51272
Gene name: BET1L
Gene alias: BET1L1|GOLIM3|GS15|HSPC197
Gene description: blocked early in transport 1 homolog (S. cerevisiae)-like
Immunogen: Recombinant protein corresponding to amino acids of human BET1L.
Immunogen sequence/protein sequence: MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMDSDFTSMTSLLTGSVKRFSTMARSGQ
Protein accession: Q9NYM9
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:1000-1:2500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23453-49-23-1.jpg
Application image note: Immunofluorescent staining of human cell line U-2 OS with BET1L polyclonal antibody (Cat # PAB23453) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli and golgi apparatus.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy BET1L polyclonal antibody now

Add to cart