| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P,WB-Tr |
| Brand: | Abnova |
| Reference: | PAB23446 |
| Product name: | OLFML1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant OLFML1. |
| Isotype: | IgG |
| Gene id: | 283298 |
| Gene name: | OLFML1 |
| Gene alias: | UNQ564 |
| Gene description: | olfactomedin-like 1 |
| Immunogen: | Recombinant protein corresponding to amino acids of human OLFML1. |
| Immunogen sequence/protein sequence: | QDPAMVHYIYQRFRVLEQGLEKCTQATRAYIQEFQEFSKNISVMLGRCQTYTSEYKSAVGNLALRVERAQRE |
| Protein accession: | Q6UWY5 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunohistochemical staining of human skeletal muscle with OLFML1 polyclonal antibody (Cat # PAB23446) shows strong cytoplasmic positivity in myocytes. |
| Applications: | IHC-P,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Thermal profiling reveals phenylalanine hydroxylase as an off-target of panobinostat.Becher I, Werner T, Doce C, Zaal EA, Togel I, Khan CA, Rueger A, Muelbaier M, Salzer E, Berkers CR, Fitzpatrick PF, Bantscheff M, Savitski MM. Nat Chem Biol. 2016 Nov;12(11):908-910. Epub 2016 Sep 26. |