N4BP2L1 polyclonal antibody View larger

N4BP2L1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of N4BP2L1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about N4BP2L1 polyclonal antibody

Brand: Abnova
Reference: PAB23375
Product name: N4BP2L1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant N4BP2L1.
Isotype: IgG
Gene id: 90634
Gene name: N4BP2L1
Gene alias: CG018
Gene description: NEDD4 binding protein 2-like 1
Immunogen: Recombinant protein corresponding to amino acids of human N4BP2L1.
Immunogen sequence/protein sequence: KIHRMKERYEHDVTFHSVLHAEKPSRMNRNQDRNNALPSNNARYWNSYTEFPNRRAHGGFTNESSYHRRG
Protein accession: Q5TBK1
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23375-48-52-1.jpg
Application image note: Immunohistochemical staining of human cerebellum with N4BP2L1 polyclonal antibody (Cat # PAB23375) shows strong cytoplasmic and nuclear positivity in purkinje cells at 1:50-1:200 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy N4BP2L1 polyclonal antibody now

Add to cart