No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P |
Brand: | Abnova |
Reference: | PAB23373 |
Product name: | KIAA1704 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant KIAA1704. |
Isotype: | IgG |
Gene id: | 55425 |
Gene name: | KIAA1704 |
Gene alias: | AD029|LSR7|RP11-245H20.2|bA245H20.2 |
Gene description: | KIAA1704 |
Immunogen: | Recombinant protein corresponding to amino acids of human KIAA1704. |
Immunogen sequence/protein sequence: | KLTKGDDDSSKPIVRESWMTELPPEMKDFGLGPRTFKRRADDTSGDRSIWTDTPADRERKAKETQEARKSSSKKDEEHILSGRD |
Protein accession: | Q8IXQ4 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:500-1:1000) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining of human oral mucosa with KIAA1704 polyclonal antibody (Cat # PAB23373) shows strong nuclear positivity in squamous epithelial cells. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |