MBD6 polyclonal antibody View larger

MBD6 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MBD6 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about MBD6 polyclonal antibody

Brand: Abnova
Reference: PAB23369
Product name: MBD6 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant MBD6.
Isotype: IgG
Gene id: 114785
Gene name: MBD6
Gene alias: KIAA1887
Gene description: methyl-CpG binding domain protein 6
Immunogen: Recombinant protein corresponding to amino acids of human MBD6.
Immunogen sequence/protein sequence: MERSPRRTHHWQHNGELAEGGAEPKDPPPPGPHSEDLKVPPGVVRKSRRGRRRKYNPTRNSNSSRQDITLEPSPTARAA
Protein accession: Q96DN6
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23369-49-23-1.jpg
Application image note: Immunofluorescent staining of human cell line U-2 OS with MBD6 polyclonal antibody (Cat # PAB23369) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy MBD6 polyclonal antibody now

Add to cart